Select a row to see which lineages the domain architecture is present in
Load an existing analysis to explore MolEvolvR results right away without inputting anything.
FASTA upload: Full analysis, for 6 bacterial proteins
FASTA upload: Full analysis, for 1 viral protein
BLAST results upload, for 1 eukaryotic protein
InterProScan results upload, for 1 viral protein
Studying proteins through the lens of evolution can reveal features such as conserved domains, lineage-specific variants, and co-occurring domain architectures in phylogenetic context across all superkingdoms. MolEvolvR enables researchers to conduct such evolution-focused studies to generate testable hypotheses about protein function and evolution. MolEvolvR is a novel web-app allowing researchers to visualize the molecular evolution of their proteins of interest in a phylogenetic context across the tree of life. It accepts multiple input formats – protein/domain sequences, homologous proteins, or domain scans – and, using a general-purpose computational workflow, returns detailed homolog data and dynamic graphical summaries (e.g., phylogenetic trees, multiple sequence alignments, domain architectures, domain proximity networks, phyletic spreads, co-occurrence patterns across lineages). MolEvolvR performs domain-centric searches to capture remote homologs that are missed by full-length searches, integrates domain architecture evolution with phyletic distribution analyses, and provides evolutionary context visualizations that reveal lineage-specific adaptations versus those that are broadly conserved. Thus, MolEvolvR is a powerful, easy-to-use web interface for computational protein characterization. The web-app can be accessed here: https://jravilab.org/molevolvr .
MolEvolvR: A web-app for characterizing proteins using molecular evolution and phylogeny
Faisal S Alquaddoomi*, Joseph T Burke*, Lo Sosinski*,
Evan P Brenner, David A Mayer, Samuel Z Chen, Jacob D Krol, Ethan P Wolfe,
Vince P Rubinetti, Shaddai Amolitos, Kellen M Reason, John B Johnston, Janani Ravi.
[*Co-primary authors]
bioRxiv 2022 (revised 2025). doi:
https://doi.org/10.1101/2022.02.18.461833
; web-app:
http://jravilab.org/molevolvr
Submit your sequence or preprocessed data here and use your retrieval code (custom URL) to view the results.
An overview of the protein analysis. To view the full results, explore the additional tabs (or click the buttons!). After exploring results and configuring graphics, you may compile a report of your results using the "Generate Report" button below. You will be notified when the report is available for download.
Download ReportVisualizations and summaries for protein domains.
Visualizations for protein evolution
Summary table of proteins including domain architectures, phylogeny, and homologs, when applicable.
Input data, additional metadata, and preliminary analyses of query protein(s).
Below are parameters selected when you submitted the analysis, as well as software versions available at the time
The data table provides a summary of the sequences submitted, or "queried", for analysis. The preview shown can be extended by using "Add/remove column(s)" to see info about other taxonomic classes as well as domain architecture codes from databases other than the default (Pfam).
Uploaded amino acid FASTA sequence(s).
A heatmap of submitted sequences and their respective taxonomic lineages.
Summary and visualizations of protein motifs/subunits (domains) and their configurations within the query protein(s) (domain architectures).
Full set of homologs of query sequences, including their lineage and domain architecture info.
All proteins are shown by default. Use the input below to select proteins to filter the table.
Visualizations and analyses of all query and homologous protein domains, structural or functional subunits, and their architectures.
Select a row to see which lineages the domain architecture is present in
Visualizations of phyletic patterns, sequence similarity, and evolution of related proteins.
* Analyses will appear only if there is at least one visible row that has values for that analysis
Help and FAQ docs for MolEvolvR
This website is free and open to all users, no login required.
This help page shows how to use MolEvolvR to its fullest potential.
Coming Soon: Videos demonstrating what you can do with MolEvolvR, and how to set up custom analyses and navigate the app after loading your results.
Proteins are the functional units of cellular processes. The goal of MolEvolvR is to characterize proteins by their sequence, structure, function, and phylogeny by using sequence similarity, domain architecture, lineages/phyletic spread, and more.
You can explore a sample set of phage shock proteins (PSP) (e.g., lia operon from Bacillus subtilis here), and the full set of PSP proteins here. We created homology, domain architecture, and phylogeny of these proteins (and genomic contexts) to show their prevalence in other organisms and detail how variations of this phage shock stress response system are present across many lineages.
We have applied the approach underlying MolEvolvR to study diverse systems, including:
You can provide a variety of protein inputs, including:
.csv format.tsv formatWith any of these inputs, proteins of interest will be analyzed to identify homologs, determine domain architectures, and delineate phyletic spreads. These analyses provide insights into the biological role(s) of the protein(s) of interest within organisms, as well as trace their evolution.
MolEvolvR can perform 4 types of analyses:
To begin, enter the amino acid FASTA sequence(s) or
accession numbers of your protein(s) of interest into the
Start Analysis tab. You can also upload a file containing
multiple FASTA sequences (.fa, .faa,
.fasta ), or accession numbers (.csv). Up to
100 protein sequences per job are accepted. For analyses with more than
100 proteins, please contact us.
MolEvolvR is designed for single proteins or small multi-protein queries (e.g., operons of 2–10 proteins); runtime scales with query count, database size, and analysis type, ranging from ~15–30 minutes for a single-protein full analysis to several hours for larger multi-protein submissions. Users with large query sets are encouraged to consider subsetting inputs to ensure optimal performance and visualization, or to contact us.
If you have a pre-existing set of homologous proteins, you can enter/upload the multiprotein FASTA or list of accession numbers. MolEvolvR can also use an MSA in FASTA/Pearson format generated through external programs such as Clustal Omega, ClustalW, Kalign, or MUSCLE.
Advanced options allow you to customize your analysis.
Selecting Phylogenetic Analysis will analyze a set of
known homologous proteins. Because this type of
analysis already uses homologs, the homology search option
will be disabled.
Selecting Homology Search will identify homologs
(related proteins) for each input protein. This pairs well with domain
architecture searches that can be obtained for all homologous hits for
each query.
Selecting Domain Architecture will characterize the
domain architecture of each protein using InterProScan, combining:
profile matching against domain and orthology databases (InterPro/Pfam,
CDD, Gene3D, COG); prediction of signal peptides (SignalP),
transmembrane regions and cellular localization (Phobius, TMHMM), and
disorder (MobiDBlite); and secondary structure annotations (Hamap,
Coils). If selected alone, no other analysis will be performed.
This option enables a domain-sensitive, divide-and-conquer homology search. MolEvolvR first runs InterProScan on the full-length query to delineate its constituent domains, then uses each identified domain# — in addition to the full-length sequence — for independent BLAST+/DELTA-BLAST searches across the tree of life. By searching with individual domains rather than the full-length sequence alone, this strategy captures remote homologs that share only a subset of domains with the query, which full-length searches routinely miss. Phylogenetic analysis, domain architecture, and characterization are then performed on all hits.
#Domains (e.g., Pfam) identified within each query protein
that are used to start these homology searches will be listed in the
Query tab.
For analyses that include a homology search, you can adjust parameters like database (default refseq), maximum hits (default 100), and E-value (default 0.00001).
You can filter your homology search results to specific organisms via
the Organism(s) to Include/Exclude dropdowns. Enter either
organism names or taxon IDs and the list will be dynamically filtered to
show only matching organisms, with your query highlighted in each list
item. The full taxonomic classification for each item is shown and is
searchable. Multiple selections are possible.
The first dropdown filters organisms to include; if empty, all organisms/taxa will be eligible for inclusion. The second dropdown filters organisms to exclude; if empty, no organisms/taxa will be excluded. If both dropdowns are used, the “include” filter will be applied first, followed by the “exclude” filter.
The filters are applied to your currently selected BLAST database (e.g., refseq, nr).
In the backend, these options are passed to BLAST as
-taxids <comma-delimited list of IDs> for the
inclusion filter and
-negative_taxids <comma-delimited list of taxon IDs>
for exclusions. See Limiting a Search by taxonomy for NCBI’s
documentation on this feature.
A homology search requires you to enter/upload protein FASTA sequence(s) or accession number(s).
If given an accession number, MolEvolvR will find its
corresponding FASTA sequence to run through DELTA-BLAST, a variation of
BLASTP. DELTA-BLAST searches pre-constructed
Position-Specific-Scoring-Matrix (PSSM) and the conserved domain
database (CDD) for accelerated lookups. Once the BLAST homology search
completes, _MolEvolvR_ clusters the resulting homolog sequences with BLASTClust and adds additional metadata by lineage
and domain architecture (when selecting the
Domain Architecture option).
You can start your analysis with a full list of accession numbers or
FASTA files for protein(s) of interest. MolEvolvR gathers
homologs of your input protein(s), and then performs domain architecture
analysis on all homolog and query sequences. You have the option to
perform only Phylogenetic Analysis or
Domain Architecture if you don’t need both.
You can start your analysis from uploaded NCBI BLAST or InterProScan results. Web-BLAST results allow you to determine homolog similarity, the domain architecture and/or phylogeny. InterProScan results summarize and visualize domains and (if accession numbers are provided) phylogeny.
BLAST is available through NCBI’s website.
You can start your analysis with data from a previous BLAST run.
These data are run through BLASTClust to cluster similar sequences among
the retrieved homologs. The Phylogenetic Analysis and
Domain Architecture options are then applied.
To ensure compatibility with the MolEvolvR
Start Analysis tab, follow these guidelines.
First, enter your accession number(s) or FASTA sequence(s) into the “Enter Query Sequence” box.
For the database parameter, we support either the non-redundant
database (nr) or the reference sequence collection
(refseq_proteins). The refseq_proteins dataset
is a high quality, non-redundant subset of protein records curated by
NCBI staff. Meanwhile, nr is a larger, non-redundant set
that includes many more sequences but is not necessarily vetted for
quality and accuracy. If you would like to further filter your results
based on lineages (e.g., species, genus, family, kingdom), enter the
name/taxID in the Organism field and toggle the box to include/exclude
those results in your search.
Next, select which algorithm to run. If you don’t know details of your protein, ‘BLASTP’ is a great place to start. If you are interested in identifying remote homologs, we suggest using ‘PSI-BLAST’. If your protein has domains of interest, ‘DELTA-BLAST’ works very well.
Creating a job title for the run is optional and for your personal convenience.
Under the expandable “Algorithm parameters” section, the defaults for
max target sequences are typically sufficient. The expect threshold
value, or E-value, represents the number of matches by pure random
chance, and filters out hits with values greater than the threshold. We
suggest 1e-5 (1x10-5 or `0.00001’) for general searches.
Double check your parameters across the page, then click the BLAST
button.
Summary of NCBI BLAST submission parameters
Once your BLAST search is complete, at the end of the RID row towards
the top of the page, there will be a Download All option
with a dropdown menu to download results. Click on the
Download All button and select the
Hit Table (csv) option. You can directly upload these
.csv result files to MolEvolvR. If the first
column of the results .csv does not include accession
numbers, you will also need to provide the query sequence(s) that you
used to run BLAST as a second file (.fa, .faa,
or .fasta format).
If you are performing a PSI-BLAST, you will have the option to run additional iterative searches upon each search’s completion. Further iterations will find more remote homologs, so it is recommended you run several iterations before downloading the Hit Table.
BLAST provides information in many formats for your protein homologs,
which we encourage you to review. However, MolEvolvR requires
the Hit Table (csv) for analysis.
Alternatively, you may upload command line BLAST results with these columns specified:
query acc.ver, subject acc.ver, % identity, alignment length, mismatches, gap opens, q. start, q. end, s. start, s. end, evalue, bit score, % positives
Check out the BLAST tutorials to learn more about BLAST.
InterProScan is available through EBI’s website.
If you have already identified your protein’s domains through InterProScan, you can upload the output to MolEvolvR for a customizable visual summary of the information.
To ensure compatibility with the MolEvolvR
Start Analysis tab, follow these guidelines.
Input your protein’s FASTA sequence by copy/pasting into the box or
uploading the FASTA file with the Choose file button. If
the sequence is valid, InterProScan will display a green check mark in
the bottom right corner of the input box. You can use the
Advanced options dropdown to select specific databases.
When finished, click the Search button to begin.
When the search completes (another green check mark will appear under Status), click on your job submission to view the output.
Under the blue Export dropdown menu, download the
results in the .tsv format. Upload the .tsv
file to MolEvolvR for visualization and further analysis. If
the first column of the results .tsv does not include
accession numbers, you will also need to provide the query protein
sequence that you used to run InterProScan as a second file (amino acid
sequence in .fa, .faa, or .fasta
format).
Check out the InterProScan tutorials to learn more about their algorithms and search parameters.
After submitting proteins to MolEvolvR, take a break!
Runtime depends on server load and on the complexity of your submission
(Full Analysis taking the most time), but you can expect
this to take 10 minutes or more.
You will receive a six character alphanumeric analysis code after
submission. We recommend saving this code before you close the app. You
will need to enter it later on the Retrieve Results tab to
view your results.
Before submitting you can provide an email to receive a link to your
analysis. The app will also save any analyses you’ve submitted on your
current device (laptop, phone, etc.), and will list them under the
Retrieve Results tab.
The Result Summary tab provides a high level
overview/snapshot of your analysis results. The top of the page includes
tiles that surface key results of the analysis, including input and job
metrics, homologs found, and lineages/domain architectures that were
identified.
From this page, you can also generate a downloadable HTML
report of your entire analysis by clicking the
Generate Report button (see Report Generation section below for
details). This report can be used offline, shared with collaborators, or
archived for reproducibility, and includes interactive graphics and
tables similar to those displayed on the MolEvolvR site.
You can explore your analysis fully with the detailed results and visualizations under the other tabs, as follows.
The Data Table tab shows the processed input data in
tabular form. The default view includes query names, species, lineage,
and their constituent Pfam domain architectures. The table can be
customized using the Add/remove column(s) button to access
the full list of available columns. Columns can be filtered by
particular species, lineages, percentage similarities, etc., and the
entire table can be searched with plain text or regex queries (see Regex section for advanced search patterns). Filters
persist across tabs, allowing you to fine-tune your
analysis by maintaining the same filter settings when exploring
different visualizations. If you see a notification that “visualizations
and data shown below are being filtered,” this reflects your active
filters — it is expected behavior, not an error. This is to ensure that
your filters are portable across tabs, and is therefore a feature, not a
bug! Dismiss the notification or clear your filters to reset. The full
data table (or any filtered subset) can be downloaded in
.csv format with the Download as csv
button.
All FASTA sequences for the query protein(s) are provided for ease of access.
A heatmap shows the occurrence of query protein(s) by taxonomic presence, which may be useful for multi-FASTA input of homologs.
A customizable domain architecture visualization shows the query
protein(s) grouped by analysis or query. You can modify the domain plot
by selecting the Analysis box and adding or removing
results to display (e.g., Pfam, Phobius, Coils analyses).
The Homolog Data page contains detailed information on all homologs identified for each query protein.
The Homolog Data table lists the best hits from all superkingdoms of
life (queried across all refseq or nr
genomes). Like in Query Data > Data Table described
above, tabular details are provided across all homologs, including
genome, species, lineage, and domain architecture information. Many
homology-specific options available in Add/remove column(s)
like percent identity, cluster ID (BLAST parameters). The accession
number for each homolog is hyperlinked to its corresponding NCBI
protein page, and domain names to EBI’s InterProScan details
pages for easy reference.
The length distribution plot shows a box-and-whisker plot of the average lengths in amino acids of homologs grouped by lineage.
The “Superkingdom Filter” dropdown allows lineages to be filtered by the superkingdom (or taxonomic domain) to which each belongs. Multiple superkingdoms can be selected, resulting in all matching lineages being displayed.
The “Query Protein Filter” restricts the plot to only homologs found for the selected query protein(s). As with the superkingdom filter, multiple query proteins can be selected, which causes all matching homologs to be displayed.
Checking the “Show Median” box renders a line at the median length across all homologs. Checking the “By Query” box changes the plot to show the length distributions of homologs per query protein.
A protein’s domain architecture (DA) refers to the order of specific functional regions of a protein. Currently, MolEvolvR uses databases and prediction algorithms integrated with InterProScan to characterize the domain architecture of protein queries and their homologs. We summarize the data with a set of useful visualizations below. Results from Pfam, Phobius, Gene3D, SignalP_Gram_positive, SignalP_Gram_negative, MobiDBlite, Hamap, and Coils are available.
The table provides summary statistics on the domain architecture data across all homologs, with the top (most frequent) domain architectures by query protein (or across all queries) and the frequencies of occurrence and lineages in which they occur. Click each row to view the domain architecture spread across lineages in an interactive popup. The popup demonstrates the ‘LineageCount’ by showing the frequencies of occurrence by individual lineage for the selected domain architecture, allowing you to quickly identify lineage-specific vs. broadly conserved domain architectures.
This stacked bar chart shows the frequency of occurrences of the top domain architectures per lineage; the domain architectures for each lineage-wise splits are displayed on the left.
A color gradient heatmap across the query protein(s) indicates the number of homologs identified within each lineage per domain architecture.
Rows: Predominant domain architectures. Columns: Key lineages from across the superkingdoms of life.
A network visualization summarizes domain architectures across query protein(s) and their homologs Nodes represent a domain and edges denote domain co-occurrence within a protein. The domains (nodes) that co-occur within a protein/domain architecture are connected (edges), and the size of nodes and thickness of edges are proportional to their relative occurrences across homologs (or query proteins).
Each column of this visualization is organized by the database the
domains were obtained from. The rows represent select query protein(s)
and/or homologs (if a homology search was performed) with the lineage
added to the front of the accession number. You can select specific
proteins with the dropdown box, and choose to group rows by
analysis or query to organize the visualization in different
ways. The visualization can also be updated by toggling available
database options under Analysis, or by adjusting the
Total Cutoff Count slider to filter the number of proteins
displayed based on the frequency of their domain architectures. The
x-axis shows residue positions relative to the start of
the protein (full-length search) or the start of the domain (when
Run Analysis by Domain is used); axis labels are therefore
relative, not absolute sequence positions.
An UpSet plot is a helpful summary visualization that shows the frequencies of domains and domain architectures across all homologs. It shows distribution of constituent domains underlying all homologs in a histogram (to the left). The combination matrix displays the various combinations of domains present across the domain architectures. The adjoining second histogram (on top) shows the frequency of occurrences of the indicated domain architectures (combinations).
Phylogenetic analysis of proteins provides key insights into their development and evolution. The conservation of certain portions through lineages or across domains of life could indicate the importance of the protein in certain biological processes.
An interactive sunburst plot shows the phyletic spread of the query
protein (selected with the Protein dropdown) across life. Hovering over
each section of the plot displays the lineage. The depth of displayed
taxonomic levels can be adjusted with Number of Levels to
add more detail to the sunburst plot (default is 3 levels for the result
summary sunburst).
This visualization is constructed from a multiple sequence alignment of representative homologs. Tree leaves are labeled by lineage, species (three-letter abbreviation), and accession numbers.
You can adjust the tree generation in two important ways: based on whether homologs are reduced to representative sequences (e.g., by lineage, species, or domain architecture), and based on the multiple sequence alignment (MSA) algorithm chosen (including Clustal Omega, Clustal W, and Muscle). The size of the tree can be adjusted by selecting the desirable number of sequences to include, allowing you to balance detail with readability. To the right of the tree is a visualization of the multiple sequence alignment, colored by amino acid and showing overall conservation of sequence and structure of the homologs used in tree construction.
You can customize and download a multiple sequence alignment as a
searchable .pdf file, including a
user-specified number of representative sequences among the homologs.
This searchable PDF format makes it easy to find specific sequences or
regions of interest within large alignments.
This visualization combines the InterProScan results from the ‘Domain Architecture’ page with the phylogenetic tree described above. The two visualizations are aligned such that the tips of the tree correspond to the rows of the InterProScan results.
The tree can be customized via the parameters described in the section above.
The InterProScan panel can be customized by selecting the
Analysis box and adding or removing InterProScan analysis
types to display (e.g., Pfam, Phobius, Coils, Gene3D). Note that even if
an analysis is selected, its corresponding column will only appear if
the corresponding InterProScan rows that align to the tree have data for
the selected analysis. Finally, following any changes to the domain
architecture or tree/leaf attributes, select Generate to
render the plot.
You can generate a comprehensive report of your analysis in HTML
format, which includes interactive figures for all the visualizations
shown in the app. Click the Generate Report button to
create the report. (This may take several minutes depending on the size
of your analysis.)
Once the report is generated, you will receive a modal popup with a
link to the results summary page. You can then click “Download Report”
to download an HTML report named
<job_code>_report.html.
If you wish to customize the parameters of the figures included in
the report, you can first navigate to the other tabs after loading an
analysis and then modify the visualizations as desired. Once you have
customized the visualizations, return to the Result Summary
tab and click Generate Report again to create a report with
your customized visualizations.
Data tables are filterable via global or column-specific search boxes
and controls. Filters are applied across the Phylogeny and
Domain Architecture tabs (indicated by a small, dismissable
notification) allowing users to fine-tune their analysis.
Columns are searched appropriately based on the data they contain. For example, the AccNum column is text searchable, while PcPositive provides sliders to specify a range of values.
Table-wide search boxes support JavaScript-flavored
regular expressions. This can be used to make advanced searches,
e.g. Staphylococcus\saureus|Klebsiella\spneumoniae (search
for staphylococcus OR klebsiella.)
This web-app is regularly tested on the following:
We only use standardized and widely-supported HTML, CSS, and JavaScript features, so any other modern, standard-compliant browser such as Opera or Microsoft Edge should also work, even if not explicitly tested.
The following are NOT supported, and may result in unexpected look or behavior:
If you encounter a bug, please let us know!
Coming soon.
We will provide video tutorials covering: how to load your data (accession numbers, FASTA file, web-BLAST results, web-InterProScan results), how to run your analyses, how to load your analysis after it has been processed, how to navigate the web-app, and how to download publication-ready figures and data!
We use the following tools to perform analyses and generate visualizations:
We use the following databases to characterize proteins and their homologs:
NCBI Taxonomy, NCBI GenBank/RefSeq; BLAST RefSeq, NR DB; InterPro
Databases, versions, and compilation dates:
nr and refseq databases v5 (Jun 10,
2023)ape, biomartr, cowplot, d3r, DT, gganimate, gggenes, ggraph, ggsci, ggthemes, ggtree, ggvis, gh, gridExtra, heatmap3, heatmaply, htmlwidgets, httr, igraph, knitr, latexpdf, pdftools, phangorn, phylogram, phylotools, phytools, plotly, rentrez, reutils, rmarkdown, seqinr, seqRFLP, shiny, shinydashboard, sunburstR, tidytext, tidytree, tidyverse, tinytex, UpSetR, viridis, visNetwork, wordcloud, wordcloud2
If you have used our web-app to generate any results for your publication or presentations, please cite us as follows:
MolEvolvR: a web-app for characterizing proteins using molecular evolution and phylogeny. Faisal S Alquaddoomi#, Joseph T Burke#, Lo Sosinski#, David A Mayer, Evan P Brenner, Samuel Z Chen, Jacob D Krol, Ethan P Wolfe, Vince P Rubinetti, Shaddai Amolitos, Kellen M Reason, John B Johnston, Janani Ravi. [#Co-primary authors] bioRxiv 2022.02.18.461833 (revised 2025); doi: https://doi.org/10.1101/2022.02.18.461833; web-app: http://jravilab.org/molevolvr
Questions? Email us at mailto:janani.ravi@cuanschutz.edu.
We would like to thank our funding sources: University of Colorado Anschutz start-up funds, Endowed Research Funds from the College of Veterinary Medicine, Michigan State University, and NSF-funded BEACON funding support awarded to JR; NSF-funded REU-ACRES summer scholarship to SZC; NIH NIAID U01AI176414 to JR; NIH NLM T15LM009451 to EPB.
Yes, if you supplied an (optional) email on the submission page, then an email will be sent to confirm when a job is ready.
>OHS91782.1 16S rRNA pseudouridine(516) synthase [Staphylococcus aureus]
MRIDKFLANMGVGTRNEVKQLLKKGLVNVNEQVIKSPKTHIEPENDKITVRGELIEYIENVYIMLNKPKG
YISATEDHHSKTVIDLIPEYQHLNIFPVGRLDKDTEGLLLITNDGDFNHELMSPNKHVSKKYEVISANPI
TEDDIQAFKEGVTLTDGKVKPAILTYIDNQTSHVTIYEGKYHQVKRMFHSIQNEVLHLRRIKIADLELDS
NLDSGEYRLLTENDFDKLNYK
>sp|P01189|COLI_HUMAN Pro-opiomelanocortin OS=Homo sapiens OX=9606 GN=POMC PE=1 SV=2
MPRSCCSRSGALLLALLLQASMEVRGWCLESSQCQDLTTESNLLECIRACKPDLSAETPM
FPGNGDEQPLTENPRKYVMGHFRWDRFGRRNSSSSGSSGAGQKREDVSAGEDCGPLPEGG
PEPRSDGAKPGPREGKRSYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEFKREL
TGQRLREGDGPDGPADDGAGAQADLEHSLLVAAEKKDEGPYRMEHFRWGSPPKDKRYGGF
MTSEKSQTPLVTLFKNAIIKNAYKKGE
Custom FASTA header (not recommended)
>SEQUENCE154 UNKNOWN
MPRSCCSRSGALLLALLLQASMEVRGWCLESSQCQDLTTESNLLECIRACKPDLSAETPM
FPG
The application uses NCBI or UniProt accessions to get taxonomy info from query proteins. Therefore, it is recommended to include valid protein accession numbers in the header when possible.
No header lines (missing > header delimiter)
MRIDKFLANMGVGTRNEVKQLLKKGLVNVNEQVIKSPKTHIEPENDKITVRGELIEYIENVYIMLNKPKG
MPRSCCSRSGALLLALLLQASMEVRGWCLESSQCQDLTTESNLLECIRACKPDLSAETPM
Duplicate headers/accnums
>GCF_000013425.1
MVPEEKGSITLSKEAAIIFAIAKFKPFKNRIKNNPQKTNPFLKLHENKKS
>GCF_000013425.1
MKQKKSKNIFWVFSILAVVFLVLFSFAVGASNVPMMILTFILLVATFGIGFTTKKKYRENDWL
>protein
MKLTLMKFFVGGFAVLLSYIVSVTLPWKEFGGIFATFPAVFLVSMFITGMQYGDKVAVHVSRGAVFGMTGVLVCILVTWM
MLHMTHMWLISIVVGFLSWFISAVCIFEAVEFIAQKRLEKHSWKAGKSNSK
>protein
MVKRTYQPNKRKHSKVHGFRKRMSTKNGRKVLARRRRKGRKVLSA
Upon submission, a url link to retrieve the results will display. The link provides job progress info and, once finished, the results.
Recommendations:
Typical runtimes range from ~15–30 minutes for a single-protein full
analysis to several hours for larger multi-protein submissions (e.g.,
operons of 5–10 proteins queried against the nr
database).
Key factors of job duration:
Number of sequences submitted
Number of homologs to search for each sequence
(Advanced Options>Maximum Hits)
Length & complexity of sequences
The computational methods underlying MolEvolvR have enabled understanding fundamental biological systems and protein evolution.
In this section, companion MolEvolvR jobs for proteins studied in these publications are provided for users to explore.